AWS Releases
Amazon Web Services releases and Terraform AWS provider. New features, breaking changes, security advisories and deprecations - each summarised in plain English and updated continuously.
Tracking 678 AWS releases · Updated
- AWS What's New awspreviewengineerhealthcare ·
AWS HealthLake adds preview resource matching for duplicate patient records
AWS HealthLake has introduced a preview feature for resource matching to automatically identify and link duplicate patient, provider, and organization records. This capability aims to improve data accuracy in healthcare by creating longitudinal patient records and enabling trustworthy population health datasets without requiring specialized MDM tools. The feature supports seven FHIR resource types and is available in a gated preview across multiple AWS regions, requiring users to join an allowlist.
feature announcement - AWS What's New networkingawsazuregapreviewengineer ·
AWS Interconnect GA enables multicloud connectivity with OCI
AWS Interconnect is now generally available, offering direct, private connections between AWS and Oracle Cloud Infrastructure (OCI) to simplify multicloud networking. This aims to reduce the complexity of managing large-scale, multi-layered networks across different cloud providers. The service is available for OCI in us-east-1, with Google Cloud support and Microsoft Azure support coming later.
feature announcement - AWS What's New aiawspreviewengineer ·
AWS Security Hub MCP App Preview Integrates Findings with Claude Desktop
AWS is previewing the Security Hub MCP App, a local server that integrates Security Hub exposure findings directly into Claude Desktop. This integration aims to accelerate security investigations by reducing context switching and enabling natural language interaction with security data. The tool provides text summaries and interactive visualizations for findings and remediation recommendations, running locally with read-only access. It is available at no additional cost in preview across commercial AWS regions.
feature announcement - AWS What's New aiawspreviewengineer ·
AWS releases open-source benchmark for AI agents on AWS
AWS has announced a research preview of aws-bench, an open-source benchmark designed to measure the accuracy and efficiency of AI agents performing tasks on AWS infrastructure. This tool addresses the need for objective, reproducible performance measurement and failure diagnosis for AI researchers and model providers. It includes a public suite of test cases based on real AWS usage scenarios and offers a CLI for easy execution and scoring, available now on GitHub.
announcement feature - AWS What's New awsgapreviewengineeraws-rds ·
Amazon RDS for MySQL adds MySQL 9.7 support in preview
Amazon RDS for MySQL now supports community MySQL 9.7 in the RDS Database Preview Environment, enabling evaluation of the latest LTS release. This allows users to test applications and new capabilities before general availability. The preview instances are retained for 60 days and priced the same as production instances in us-east-1.
feature announcement - AWS What's New infraawspreviewengineerfinanceenergyaws-ec2 ·
AWS KNFSD File Cache enters preview to accelerate NFS performance
AWS has announced the preview of KNFSD File Cache, an open-source solution to deploy a high-speed NFS cache on AWS. This service offers significant performance gains for read-heavy workloads by caching data in memory and on local NVMe storage, reducing latency for compute fleets. It supports various NFS sources and clients, is built on standard Linux technologies, and is available across all AWS Regions, with users only paying for consumed resources.
feature announcement - AWS What's New awspreviewengineeraws-rds ·
Amazon RDS PostgreSQL 19 Beta 2 Now in Preview Environment
Amazon RDS for PostgreSQL 19 Beta 2 is now available in the RDS Database Preview Environment for evaluation. This pre-release version brings features like parallel autovacuum, native SQL Property Graph Queries, and dynamic logical replication for improved performance and reduced downtime. Beta 2 includes bug fixes and stability enhancements from Beta 1 testing, offering a managed environment for testing PostgreSQL 19's capabilities before general availability.
feature announcement - AWS Open Source Blog blogaiawspreviewengineeraws-eksaws-iam ·
Build Stateful IT Service Desk Agent with LangGraph on EKS
This post demonstrates building an AI-powered IT service desk agent using LangGraph on Amazon EKS that can autonomously handle routine L1 support requests and escalate complex issues to human engineers. The agent leverages LangGraph's stateful workflow capabilities, such as interrupt() and checkpointing, with Amazon DynamoDB for state persistence, providing context-preserving escalations and durable state across failures. The solution uses Amazon OpenSearch Serverless for retrieval, Anthropic's Claude on Amazon Bedrock for generation, and Karpenter for efficient node autoscaling, offering a portable and scalable pattern for IT support automation.
feature announcement - AWS News Blog bloginfraawspreviewengineer ·
AWS Transform adds continuous tech debt analysis and remediation (preview)
AWS Transform now includes a continuous modernization capability for autonomous tech debt analysis and remediation at scale, addressing the fragmentation of existing tooling and the rapid accumulation of debt due to AI-assisted development. This new feature provides continuous code scanning, prioritized findings, and automated pull request generation for fixes, helping engineering organizations reduce manual effort and maintain code currency. It is available today in preview and integrates with AWS Security Agent.
feature announcement - AWS News Blog bloginfraawspreviewengineer ·
AWS DevOps Agent adds preview release management features
AWS DevOps Agent now offers preview release management capabilities, including release readiness reviews and autonomous release testing. These features aim to help teams assess code changes against production standards and automatically test them, addressing the increased volume of code, especially from AI tools. The capabilities are designed for engineers and architects working with CI/CD pipelines across AWS, multicloud, and on-premises environments.
feature announcement - AWS What's New aiawspreviewengineeraws-sagemaker ·
SageMaker JumpStart offers OpenAI PII detection and masking model
Amazon SageMaker JumpStart now provides a privacy-filter model from OpenAI for detecting and masking personally identifiable information (PII) in text. This feature allows AWS customers to build data sanitization workflows on AWS infrastructure, making it easier to comply with privacy regulations. The model is readily deployable via SageMaker Studio or the Python SDK for various AI use cases.
feature announcement - AWS What's New aiawspreviewengineeraws-eks ·
AWS Neuron 2.31.0 enhances performance and adds EKS operator
AWS Neuron 2.31.0 introduces significant updates, including enhanced MX FP8 support and tensor layout transformations in NKI 0.5.0. A public beta of the Neuron UltraServer Operator for Amazon EKS aims to automate UltraServer workloads. These updates benefit engineers and architects working with AWS Trainium and Inferentia chips for AI/ML workloads, particularly those on EKS, by improving performance and simplifying configuration.
feature patch - AWS What's New observabilityawspreviewengineeraws-eks ·
CloudWatch Application Signals Adds Automatic Service Event Capture
Amazon CloudWatch Application Signals now automatically captures exception, latency, function-level performance, and deployment events without code changes. This helps users quickly identify deployment-related errors and performance issues. The feature is available to applications with Application Signals enabled via ADOT SDKs or the EKS add-on, and supports Java, Python, and JavaScript in all commercial AWS Regions.
feature - AWS What's New observabilityawspreviewengineer ·
CloudWatch Application Signals adds dynamic instrumentation
Amazon CloudWatch Application Signals now supports dynamic instrumentation, allowing developers to capture runtime state from live applications without restarts. This feature helps debug difficult-to-reproduce production issues by inspecting variable values and method arguments at specific code locations. It requires the AWS Distro for OpenTelemetry (ADOT) SDKs and is available in all commercial AWS regions for Java, Python, and JavaScript/TypeScript applications.
feature - AWS What's New securityawspreviewengineeraws-ec2 ·
EC2 Dedicated Hosts Add AMD SEV-SNP Support
Amazon EC2 now supports AMD SEV-SNP on Dedicated Hosts, allowing confidential computing workloads on dedicated physical servers. This provides confidential computing benefits alongside Dedicated Host features like placement control and host affinity. The feature is available in all AWS commercial regions with AMD instances.
feature - AWS What's New networkingawspreviewengineer ·
AWS Interconnect last mile enters gated preview with AT&T
AWS Interconnect - last mile is a new managed offering simplifying private, high-speed connections to AWS from on-premises locations. It automates complex network configuration, reduces setup friction, and ensures high availability. This new service is now available in a gated preview with AT&T for US customers, offering simplified partner adoption via an API.
feature announcement - AWS What's New securityawspreviewengineer ·
AWS Security Agent expands to new regions with threat modeling and code review
AWS Security Agent, now part of AWS Continuum, is now available in three new AWS regions: Asia Pacific (Mumbai), Asia Pacific (Singapore), and South America (São Paulo). This expansion offers customers enhanced security capabilities, including preview features for STRIDE-based threat modeling and full-repo/PR-level code reviews across popular platforms. On-demand penetration testing and simulated validation (US East only) are also available, aiming to scale security expertise alongside development velocity.
feature announcement - Terraform AWS Provider Releases terraforminfraawspreviewdeprecationengineerretailaws-bedrock ·
Terraform AWS Provider v6.53.0: New Bedrock features, breaking changes, and enhancements
Terraform AWS Provider v6.53.0 introduces new data sources and resources for AWS Bedrock, alongside breaking changes in Pinpoint SMS Voice V2 phone number management. It also includes several enhancements and bug fixes across services like API Gateway, ECS, and CloudWatch. Users should review the breaking changes and deprecations for potential impact on their infrastructure as code.
breaking feature patch announcement - AWS What's New aiawsgapreviewengineerhealthcare ·
Amazon WorkSpaces for AI agents now generally available
Amazon WorkSpaces for agents is now generally available, allowing AI agents to securely operate desktop applications without modernization. This enables automation of critical business workflows like claims processing and trade settlement by providing agents with managed cloud workspaces that offer the same security and governance as human users. The service supports any agent framework using Model Context Protocol (MCP) and offers features like real-time session control and domain-joined fleet support.
feature announcement - AWS What's New aiawspreviewengineer ·
Amazon Connect launches Agentic CX designer in preview
Amazon Connect now offers Agentic CX designer, a no-code canvas for building AI-powered self-service experiences, in preview. This feature combines agentic and deterministic AI to transform customer service, enabling business teams to design, test, and deploy experiences faster. It also introduces Live Sync, which guides users through web or mobile apps in real-time during voice or chat interactions, creating a unified guided experience.
feature announcement
About AWS release tracking on ReleaseBytes
AWS ships hundreds of service updates a month across EC2, Lambda, RDS, S3, EKS and the rest of the catalogue — far more than anyone can follow by reading the official What's New feed. ReleaseBytes ingests announcements from AWS's official release channels and the Terraform AWS provider changelog, summarises each one in plain English, and tags anything that is a breaking change, security advisory or deprecation so you can see at a glance whether it affects your workloads.
Frequently asked questions
How often are AWS release notes updated on ReleaseBytes? ›
Continuously. ReleaseBytes monitors the official AWS release channels around the clock and publishes a plain-English summary of each announcement shortly after it lands.
What kinds of AWS changes does ReleaseBytes track? ›
New features, enhancements, bug fixes, security advisories, breaking changes, deprecations and end-of-life announcements. Every item is tagged by type so you can filter to just the changes that need action.
How can I get alerts for new AWS releases? ›
Set up a free email or Slack alert filtered to AWS, subscribe to the weekly digest, or follow the RSS feed. Teams can also install the ReleaseBytes GitHub App or connect via MCP.
Where does the AWS release data come from? ›
From the official sources: Amazon Web Services releases and Terraform AWS provider. Every item links back to the original vendor announcement.