GCP Releases
Google Cloud releases and Terraform Google provider. New features, breaking changes, security advisories and deprecations - each summarised in plain English and updated continuously.
Tracking 834 GCP releases · Updated
- Google Cloud release notes aigcpgapreviewengineer ·
Gemini Enterprise Updates: Crossbeam, Gemini 3.5 Flash, and NotebookLM
Gemini Enterprise now supports connecting Crossbeam data stores in public preview and offers Gemini 3.5 Flash in general availability across multiple regions. NotebookLM Enterprise also gains GA for creating slide decks and infographics. These updates benefit Gemini Enterprise users, offering enhanced data integration and improved AI model access, alongside new content generation capabilities in NotebookLM.
feature - Google Cloud release notes infragcpengineer ·
Config Connector 1.151.0 adds Alpha resources, new fields
Config Connector version 1.151.0 introduces new Alpha resources, including CloudDeployAutomation and VertexAIDataLabelingJob, enhancing deployment and AI capabilities. Several fields were added or updated for MemorystoreInstance, providing more control over backups and replication. Bug fixes for BigQueryDataTransferConfig and ContainerCluster improve stability and resource management. This release is for users managing GCP resources via Kubernetes.
feature patch announcement - Google Cloud release notes aiawsengineer ·
Cloud Load Balancing: Google tag gateway for advertisers
Google Cloud now offers a Google tag gateway for advertisers, enabling website owners to manage and deploy Google tags via Cloud Load Balancing. This feature routes measurement traffic through your domain using a global external Application Load Balancer, enhancing data accuracy for advertising campaign optimization. It is now available for use, with detailed information provided in the documentation.
feature - Google Cloud release notes governancegcppreview ·
GCP VPC: Org Policy Custom Constraints GA, Peering Deletion Cancel Preview
Google Cloud's Virtual Private Cloud (VPC) now offers General Availability for Organization Policy Service custom constraints, enabling finer control over VPC resources as of December 19, 2023. Additionally, a new preview feature allows users to cancel pending deletion requests for VPC Network Peering connections in consensus mode. These updates enhance resource management and operational flexibility for GCP users managing network configurations.
feature - Google Cloud release notes governancegcpgaarchitect ·
Oracle Database@Google Cloud Adds Autonomous Data Guard
Oracle Database@Google Cloud now supports Autonomous Data Guard for local peer databases, bringing enhanced disaster recovery capabilities to users. This feature is now Generally Available, offering production-ready disaster recovery for Oracle databases hosted within Google Cloud. The enhancement is relevant for Oracle database administrators and architects managing critical workloads on Google Cloud.
feature - Google Cloud release notes infragcppreview ·
Certificate Manager (2nd gen) reaches Preview
Google Cloud's Certificate Manager (2nd gen) is now available in Preview. This update provides a unified control plane for managing and automating certificates across an organization. It is accessible to users interested in advanced certificate management capabilities.
feature - Google Cloud release notes infragcpgaengineer ·
Apigee hybrid v1.16.3 release: Guardrail env vars, Redis fix
Google has released Apigee hybrid version v1.16.3, a patch update that includes a fix for the apigee-redis pod CrashLoopBackOff state when using Vault-based secret injection. This release also introduces custom environment variable support for Guardrail pods, allowing configuration of NO_PROXY to bypass HTTP proxies for internal endpoints. The update is available for existing installations and new deployments, with specific instructions for upgrading.
feature patch announcement - Google Cloud release notes datagcpengineergcp-spanner ·
Spanner graph query performance optimized with factorized execution
Spanner now supports factorized execution to optimize graph query performance by eliminating duplicate intermediate results. This feature benefits engineers and architects working with graph patterns in Spanner, potentially reducing query latency. The optimization is applied using the @{factorize_mode} hint at the query or pattern traversal level.
feature - Google Cloud release notes securitygcpgadeprecationengineergcp-cloud-storage ·
Google SecOps SIEM Data Export API GA with Enhancements
Google SecOps SIEM's enhanced Data Export API is now generally available, offering improved security and scalability for exporting security data to Google Cloud Storage. Key new features include advanced data filtering, zero-trust encryption with customer-managed keys, and identity-aware extraction via RBAC. Legacy export APIs and specific endpoints are deprecated with an end-of-life date of June 18, 2026, requiring users to update their API calls to the new v1 endpoint.
deprecation feature - Google Cloud release notes awsgapreviewengineer ·
NetApp Volumes Flex Unified and replication reach GA
Google Cloud NetApp Volumes Flex Unified service level is now available with limited performance in several regions, and generally available in one additional region. Replication features for Flex Unified volumes are now generally available across all supported protocols and regions. ONTAP-mode also gains GA for S3 endpoints, thick clone splitting, and privilege levels, with backup capabilities in preview.
feature - Google Cloud release notes securitygcpgadeprecationengineergcp-cloud-storage ·
Google SecOps Enhanced Data Export API GA with Security Improvements
The Google SecOps Data Export API is now generally available with enhanced security and data filtering capabilities, allowing bulk export of security data to customer-controlled Google Cloud Storage buckets. This upgrade provides a more secure and scalable archival experience with features like customer-managed encryption keys and RBAC integration. Users must update their API settings to use the new v1 endpoint, and legacy endpoints will be deprecated by June 18, 2026.
deprecation feature - Google Cloud release notes datagcpengineer ·
Bigtable enables row-affinity routing for standard app profiles
Google Cloud Bigtable now supports row-affinity routing for standard app profiles, which can improve read latency for geographically distributed applications. This feature is now available for enabling via the Google Cloud console. It primarily benefits engineers and architects managing globally distributed Bigtable deployments.
feature - Google Cloud release notes infragcpgaengineer ·
Cloud Workstations supports persistent directory resizing
Google Cloud Workstations now supports resizing persistent directories attached to workstations. This feature allows users to adjust storage capacity as needed, accommodating growing project requirements without manual intervention. It is now generally available for all Cloud Workstations users.
feature - Google Cloud release notes datagcpgapreviewengineergcp-bigquery ·
BigQuery Enhances Reservation Management and Studio
BigQuery now allows grouping reservations to prioritize idle slot sharing, offering better control over high-priority workloads. A new organization policy feature, currently in preview, enables custom control over workload management resources. Additionally, BigQuery Studio now supports Git repositories for managing and versioning SQL scripts and notebooks, also in preview.
feature - Google Cloud release notes aigcpgaengineer ·
Gemini Enterprise: Agent Designer defaults to Gemini 3.1 Pro
Gemini Enterprise's Agent Designer now defaults to Gemini 3.1 Pro for new agents in US and Global regions. This change aims to provide improved performance for users, with existing agents already migrated to the new default model. Users can still select Gemini 2.5 Pro or Gemini 2.5 Flash after creation or manually revert their agents if preferred.
feature - Terraform Google Provider Releases terraforminfra ·
Terraform Google Provider v7.32.0: New Resources and Compute Improvements
HashiCorp has released version 7.32.0 of the Terraform Google Provider, introducing new resources for Chronicle and Compute Engine IAM policies, alongside several compute-related enhancements and bug fixes. These changes primarily affect engineers and architects managing Google Cloud infrastructure via Terraform, enabling finer-grained control over various services. Notable additions include IAM policy management for regional instant snapshots and new configuration options for compute instances and security policies.
feature patch announcement - Terraform Google Provider Releases terraforminfragcpgapreviewengineergcp-bigquerygcp-firestore ·
Terraform Provider for Google Cloud v7.31.0: New Resources and Enhancements
Terraform Provider for Google Cloud v7.31.0 introduces several new data sources and resources, including `google_artifact_registry_file` and various `google_contact_center_insights` resources. It also includes numerous improvements to existing resources, such as adding new fields for Cloud Deploy, Compute Engine, and Dataplex, alongside bug fixes for BigQuery, Cloud Scheduler, and Service Networking. This release impacts engineers and architects managing Google Cloud infrastructure via Terraform, with fixes addressing potential perpetual diff issues and new capabilities for managing artifact registries and contact center insights.
feature patch announcement - Terraform Google Provider Releases terraforminfragcp-bigquery ·
Terraform Google Provider v7.30.0: New resources, improvements, and bug fixes
Terraform Google Provider version 7.30.0 introduces new resources for Data Lineage, Artifact Registry, and Document AI, alongside significant improvements across services like BigQuery, Cloud Run, and Compute Engine. A breaking change affects the Apigee provider, requiring the 'name' field for `google_apigee_env_keystore`. These updates provide enhanced capabilities and stability for managing GCP resources via Terraform, impacting users across various GCP services.
breaking feature patch announcement - Terraform Google Provider Releases terraforminfragcppreviewengineergcp-bigquerygcp-dataproc ·
Terraform Google Provider v7.29.0 Adds New Resources and Fixes Bugs
Terraform Google Provider version 7.29.0 introduces several new resources, including support for Chronicle and Dataform, and enhances existing resources with new fields for Alloydb, Cloud Deploy, and more. These updates benefit engineers managing Google Cloud infrastructure via Terraform by expanding resource coverage and improving configuration options. The release also addresses multiple bugs, such as issues with Apigee target server settings and BigQuery dataset defaults, ensuring more reliable infrastructure management.
feature patch announcement - Terraform Google Provider Releases terraforminfragcpengineergcp-bigquery ·
Terraform Google Provider v7.28.0: New Resources and Compute Enhancements
Terraform Google Provider version 7.28.0 introduces several new resources for Vertex AI, Apigee, and Chronicle, alongside enhancements to Compute Engine and BigQuery configurations. These updates provide expanded control over GCP services for Terraform users, including new AI-related resources and improved instance management capabilities. The release includes bug fixes for Apigee, BigQuery, and Vertex AI. This update is relevant for users managing Google Cloud infrastructure with Terraform.
feature patch announcement
About GCP release tracking on ReleaseBytes
Google Cloud publishes release notes per product — BigQuery, GKE, Cloud Run, Cloud SQL, Vertex AI and dozens more — which makes platform-wide awareness hard. ReleaseBytes aggregates the official GCP release notes and the Terraform Google provider changelog into a single feed, with a plain-English summary of each update and tags for breaking changes, deprecations and security fixes.
Frequently asked questions
How often are GCP release notes updated on ReleaseBytes? ›
Continuously. ReleaseBytes monitors the official GCP release channels around the clock and publishes a plain-English summary of each announcement shortly after it lands.
What kinds of GCP changes does ReleaseBytes track? ›
New features, enhancements, bug fixes, security advisories, breaking changes, deprecations and end-of-life announcements. Every item is tagged by type so you can filter to just the changes that need action.
How can I get alerts for new GCP releases? ›
Set up a free email or Slack alert filtered to GCP, subscribe to the weekly digest, or follow the RSS feed. Teams can also install the ReleaseBytes GitHub App or connect via MCP.
Where does the GCP release data come from? ›
From the official sources: Google Cloud releases and Terraform Google provider. Every item links back to the original vendor announcement.